Isaiahtwright17 Isaiahtwright17
  • 24-02-2020
  • History
contestada

in the years after wwII what was the united states reaction as communism spread to many countries including china
​

Respuesta :

yherandezventura1234 yherandezventura1234
  • 24-02-2020

Answer:

WAHJEWVQFJTEWCJyracdJTGASJasgfty

Explanation:

qwnbvkatqftyiwyqwfrriwqereqwerwqrerqw

Answer Link
btisthebest2 btisthebest2
  • 15-02-2021

Answer:

b

Explanation:

Answer Link

Otras preguntas

Explain how the cultural scripts of interdependent cultures might differ from those of individualistic cultures.
What is the name of the screen symbol that shows the placement of the next character Options Mouse Cursor Track Ball Space Bar
Why is scientific notation used? to round numbers to the nearest whole number. to promote reproducibility of data. to increase the validity of data. to express
-5g - 6 for g= -2 A. 4 B. 16 C. 10 D. -13
A historian's analysis of events involves knowing the difference between facts and theory. a. True b. False
Almost every cell in the human body is replaced every few years through the process of _____. duplication meiosis mitosis replication
does it make sense to connect the points on the graph with a solid line?
Molecules helped by protein; move insoluble molecules across plasma membrane: pinocytosispassive diffusionfacilitated diffusionphagocytosisactive transport
the presence of many different churches in the colony of New Jersey indicated that
Which base does NOT belong to DNA? Select one: a. Guinine b. Cytocine c. Adenine d. Uracil